PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thhalv10016040m
Common NameEUTSA_v10016040mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
Family ARR-B
Protein Properties Length: 623aa    MW: 70036.3 Da    PI: 5.5186
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thhalv10016040mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like70.62.4e-22227280155
          G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                      k ++ W+  LH+ F++a++++ G +kA+Pk+ile+m+v+ Lt+e+v+SHLQkYR 
  Thhalv10016040m 227 KSKISWSDYLHDLFLQAIRHI-GLDKAVPKKILEFMNVDYLTRENVASHLQKYRQ 280
                      6799*****************.********************************5 PP

2Response_reg74.15.3e-25181341110
                      EEEESSSHHHHHHHHHHHHHTTC.....EEEE..EESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHH CS
     Response_reg   1 vlivdDeplvrellrqalekegy.....eeva..eaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeed 85 
                      v++vdD+p++++++ ++lek++y     +e++  +++d++eal +l+ ++  +Dli++D  mpgm+Gl+l kei++e  +lp+iv+++ ++   
  Thhalv10016040m  18 VMVVDDDPVFLQIMSRMLEKSKYrdpsiMEITviAVKDSREALSTLQIQRnnIDLIVTDYYMPGMNGLQLKKEITREFGNLPVIVISSDSN--K 109
                      89*****************88886665544444599********99555555**********************99999********8777..6 PP

                      HHHHHHTTESEEEESS--HHHHHHH CS
     Response_reg  86 alealkaGakdflsKpfdpeelvka 110
                       +e l  Ga+ f+ Kp++  +l+k 
  Thhalv10016040m 110 EQESLTCGAMCFIPKPIKATDLTKI 134
                      799*****************99886 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:3.40.50.23001.5E-279135No hitNo description
SuperFamilySSF521725.12E-2516147IPR011006CheY-like superfamily
SMARTSM004482.5E-2316135IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011033.75717139IPR001789Signal transduction response regulator, receiver domain
PfamPF000726.7E-2218135IPR001789Signal transduction response regulator, receiver domain
CDDcd001561.28E-2419139No hitNo description
SuperFamilySSF466891.27E-16226284IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.8E-22226284IPR009057Homeodomain-like
TIGRFAMsTIGR015573.9E-25227280IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 623 aa     Download sequence    Send to blast
MAFAQSFYNQ NSGLRISVMV VDDDPVFLQI MSRMLEKSKY RDPSIMEITV IAVKDSREAL  60
STLQIQRNNI DLIVTDYYMP GMNGLQLKKE ITREFGNLPV IVISSDSNKE QESLTCGAMC  120
FIPKPIKATD LTKIYQLAIT YKRNGKSILW TEHNHQDTDH VTIPQQIQLL PEQANVLKTK  180
KKRKFSPRSV PRSLNSSNGS CVSTDGSRKN RKRSGDDVES LSKPAKKSKI SWSDYLHDLF  240
LQAIRHIGLD KAVPKKILEF MNVDYLTREN VASHLQKYRQ FLRKVAERGV CCSSMLSGRG  300
IDSIFAYAHI TEPYYNNYTA TTSWYDTSLN NRSFYSKPGH GFGQSRLLSN PREPIRSNQM  360
PYNYMNRSST YQPLRNGSSL TLPISGNLNF PTQPSENGGR RSFFESTGVA NYTGQTSQVL  420
GFGQHGPLAI NDNNFENNTV SSCGSLTPNQ PGRASHLLYG IELFLNNENT ASMPQPHANA  480
TTEPNLGIPE LENLSLYDDL GNINELPCDI SNFQLDNNKP QEEAVSTTQF ELPASFPTEL  540
NEIFSPGEEG DWTFVNINQG HSDGETSNIF AAPETNSPII NINPNQIQER DDPDFIDWSL  600
LDPQDLANEF DFMDSLFNND MN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A1e-19226286464ARR10-B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006399202.10.0hypothetical protein EUTSA_v10016040mg
SwissprotQ9LYP50.0ARR21_ARATH; Putative two-component response regulator ARR21
TrEMBLV4KRT80.0V4KRT8_EUTSA; Uncharacterized protein
STRINGAT5G07210.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM61131737
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G07210.10.0response regulator 21